Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Medium-wave-sensitive opsin 3 (OPSG3), partial, Biotinylated

This Recombinant Human Medium-wave-sensitive opsin 3 (OPSG3), partial, Biotinylated spans the amino acid sequence from region 1-52. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Medium-wave-sensitive opsin 3; Green cone photoreceptor pigment; Green-sensitive opsin; GOP; opsin 1 cone pigments medium-wave-sensitive 3; OPN1MW3

UniProt

P0DN78

Expression Region

1-52

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MAQQWSLQRLAGRHPQDSYEDSTQSSIFTYTNSNSTRGPFEGPNYHIAPRWV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PDAP1 (28kD Heat-and Acid-stable Phosphoprotein, PDGF-associated Protein, PAP, PDGFA-associated Protein 1, PAP1, HASPP28) (MaxLight 550)
131027-ML550 100 µL

PDAP1 (28kD Heat-and Acid-stable Phosphoprotein, PDGF-associated Protein, PAP, PDGFA-associated Protein 1, PAP1, HASPP28) (MaxLight 550)

Sign In for Pricing
View Details
Lentiviral mouse Cstf3 shRNA (UAS) - Lentiviral mouse Cstf3 shRNA (UAS) plasmid
GTR15145027 1 Vial

Lentiviral mouse Cstf3 shRNA (UAS) - Lentiviral mouse Cstf3 shRNA (UAS) plasmid

Sign In for Pricing
View Details
Levocetirizine N-benzylamide
AWB31068-01 0.025 g

Levocetirizine N-benzylamide

Sign In for Pricing
View Details
Levocetirizine N-benzylamide
AWB31068-02 0.05 g

Levocetirizine N-benzylamide

Sign In for Pricing
View Details
Levocetirizine N-benzylamide
AWB31068-03 0.1 g

Levocetirizine N-benzylamide

Sign In for Pricing
View Details
CIR1A Rabbit Polyclonal Antibody
JOT-AP07817-01 20 µL

CIR1A Rabbit Polyclonal Antibody

Sign In for Pricing
View Details