Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin gamma-1 heavy chain (IGG1), Biotinylated

This Recombinant Human Immunoglobulin gamma-1 heavy chain (IGG1), Biotinylated spans the amino acid sequence from region 1-449. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin gamma-1 heavy chain; Immunoglobulin gamma-1 heavy chain NIE

UniProt

P0DOX5

Expression Region

1-449

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QVQLVQSGGGVVQPGRSLRLSCAASGFTFSRYTIHWVRQAPGKGLEWVAVMSYNGNNKHYADSVNGRFTISRNDSKNTLYLNMNSLRPEDTAVYYCARIRDTAMFFAHWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

L-Phenylalanine-¹³C₉ (9CI)
TRC-P335557-1MG 1 mg

L-Phenylalanine-¹³C₉ (9CI)

Sign In for Pricing
View Details
Tissue, Genomic DNA, Rat Adult Normal, Kidney, BioGenomicsTM
T5595-1975 100 µg

Tissue, Genomic DNA, Rat Adult Normal, Kidney, BioGenomicsTM

Sign In for Pricing
View Details
Mouse Monoclonal GITR Ligand/TNFSF18 Antibody (109114) [PE]
FAB6942P 0.1 mL

Mouse Monoclonal GITR Ligand/TNFSF18 Antibody (109114) [PE]

Sign In for Pricing
View Details
SEC61B Protein Vector (Mouse) (pPM-C-His)
PV227465 500 ng

SEC61B Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details
MTMR2 Polyclonal Antibody, RBITC Conjugated
bs-11733R-RBITC 100 µL

MTMR2 Polyclonal Antibody, RBITC Conjugated

Sign In for Pricing
View Details
SNORD90 CRISPR All-in-one AAV vector set (with saCas9)(Human)
44944151 3x 1.0 µg DNA

SNORD90 CRISPR All-in-one AAV vector set (with saCas9)(Human)

Sign In for Pricing
View Details