Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Probable non-functional immunoglobulin heavy variable 1-38-4 (HV384), Biotinylated

This Recombinant Human Probable non-functional immunoglobulin heavy variable 1-38-4 (HV384), Biotinylated spans the amino acid sequence from region 20-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Probable non-functional immunoglobulin heavy variable 1-38-4 IGHV1-38-4 IGHV1-C

UniProt

P0DTW3

Expression Region

20-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QVQLVQSWAEVRKSGASVKVSCSFSGFTITSYGIHWVQQSPGQGLEWMGWINPGNGSPSYAKKFQGRFTMTRDMSTTTAYTDLSSLTSEDMAVYYYAR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Goose Perforin/Pore-Forming Protein (PF/PFP) ELISA Kit
MBS9912003 Inquire

Goose Perforin/Pore-Forming Protein (PF/PFP) ELISA Kit

Sign In for Pricing
View Details
RPhl p 7 (g210)
ED7460 25 Tests

RPhl p 7 (g210)

Sign In for Pricing
View Details
DLD siRNA (h)
sc-62218 10 µM

DLD siRNA (h)

Sign In for Pricing
View Details
Recombinant Hydra vulgaris PC3-like endoprotease variant B, partial
MBS1168588 Inquire

Recombinant Hydra vulgaris PC3-like endoprotease variant B, partial

Sign In for Pricing
View Details
Recombinant RABV Nucleoprotein, His, Yeast-500ug
QP7060-ye-500ug 500ug

Recombinant RABV Nucleoprotein, His, Yeast-500ug

Sign In for Pricing
View Details
RAET1G sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)
K1780606 1.0 µg DNA

RAET1G sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)

Sign In for Pricing
View Details