Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Poly-ADP-ribosylation-amplifying and CtIP-maintaining micropeptide (PACMP), Biotinylated

This Recombinant Human Poly-ADP-ribosylation-amplifying and CtIP-maintaining micropeptide (PACMP), Biotinylated spans the amino acid sequence from region 1-44. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Poly-ADP-ribosylation-amplifying and CtIP-maintaining micropeptide; PAR-amplifying and CtIP-maintaining micropeptide; MARCHF6-DT PACMP

UniProt

P0DW81

Expression Region

1-44

Origin

Homo sapiens (Human)

Field of Research

Epigenetics & Chromatin

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MAASGGTKKAQSGGRRLREPSSRPSRRARQRPRRGALRKAGRFL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bag3 Rabbit Polyclonal Antibody (PE)
orb2619364 100 µg

Bag3 Rabbit Polyclonal Antibody (PE)

Sign In for Pricing
View Details
Human Transferrin (TRF) ELISA Kit
CK-bio-13767-01 48 Tests

Human Transferrin (TRF) ELISA Kit

Sign In for Pricing
View Details
Human Transferrin (TRF) ELISA Kit
CK-bio-13767-02 96 Tests

Human Transferrin (TRF) ELISA Kit

Sign In for Pricing
View Details
Human Transferrin (TRF) ELISA Kit
CK-bio-13767-03 5x 96 Tests

Human Transferrin (TRF) ELISA Kit

Sign In for Pricing
View Details
Human Transferrin (TRF) ELISA Kit
CK-bio-13767-04 10x 96 Tests

Human Transferrin (TRF) ELISA Kit

Sign In for Pricing
View Details
SPINK5 ORF Vector (Human) (pORF)
ORF033285 1.0 µg DNA

SPINK5 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details