Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Zinc finger protein 45 (ZNF45), Biotinylated

This Recombinant Human Zinc finger protein 45 (ZNF45), Biotinylated spans the amino acid sequence from region 1-682. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Zinc finger protein 45; BRC1744; Zinc finger protein 13; Zinc finger protein KOX5; ZNF45 KOX5 ZNF13

UniProt

Q02386

Expression Region

1-682

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MTKSKEAVTFKDVAVVFSEEELQLLDLAQRKLYRDVMLENFRNVVSVGHQSTPDGLPQLEREEKLWMMKMATQRDNSSGAKNLKEMETLQEVGLRYLPHEELFCSQIWQQITRELIKYQDSVVNIQRTGCQLEKRDDLHYKDEGFSNQSSHLQVHRVHTGEKPYKGEHCVKSFSWSSHLQINQRAHAGEKPYKCEKCDNAFRRFSSLQAHQRVHSRAKSYTNDASYRSFSQRSHLPHHQRVPTGENPYKYEECGRNVGKSSHCQAPLIVHTGEKPYKCEECGVGFSQRSYLQVHLKVHTGKKPYKCEECGKSFSWRSRLQAHERIHTGEKPYKCNACGKSFSYSSHLNIHCRIHTGEKPYKCEECGKGFSVGSHLQAHQISHTGEKPYKCEECGKGFCRASNLLDHQRGHTGEKPYQCDACGKGFSRSSDFNIHFRVHTGEKPYKCEECGKGFSQASNLLAHQRGHTGEKPYKCGTCGKGFSRSSDLNVHCRIHTGEKPYKCERCGKAFSQFSSLQVHQRVHTGEKPYQCAECGKGFSVGSQLQAHQRCHTGEKPYQCEECGKGFCRASNFLAHRGVHTGEKPYRCDVCGKRFRQRSYLQAHQRVHTGERPYKCEECGKVFSWSSYLQAHQRVHTGEKPYKCEECGKGFSWSSSLIIHQRVHADDEGDKDFPSSEDSHRKTR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal METTL1 Antibody (9C2F2) [mFluor Violet 610 SE]
NBP3-06651MFV610 0.1 mL

Mouse Monoclonal METTL1 Antibody (9C2F2) [mFluor Violet 610 SE]

Sign In for Pricing
View Details
Grik1, IN (EAA3, EEA3, Excitatory amino acid receptor 3, GLR5, GluR5, GLUR5, GluR-5, Glutamate receptor, ionotropic kainate 1 precursor, Glutamate receptor 5)
G4005-96C 100 µg

Grik1, IN (EAA3, EEA3, Excitatory amino acid receptor 3, GLR5, GluR5, GLUR5, GluR-5, Glutamate receptor, ionotropic kainate 1 precursor, Glutamate receptor 5)

Sign In for Pricing
View Details
Olr221 sgRNA CRISPR Lentivector set (Rat)
K7260101 3x 1.0 µg

Olr221 sgRNA CRISPR Lentivector set (Rat)

Sign In for Pricing
View Details
B3GNT3 (Transmembrane Protein 3, beta-1,3-N-acetylglucosaminyltransferase 3, TMEM3, B3GN-T3, B3GNT-3, HP10328, B3GAL-T8, beta3Gn-T3) discontinued
209699-01 50 µL

B3GNT3 (Transmembrane Protein 3, beta-1,3-N-acetylglucosaminyltransferase 3, TMEM3, B3GN-T3, B3GNT-3, HP10328, B3GAL-T8, beta3Gn-T3) discontinued

Sign In for Pricing
View Details
B3GNT3 (Transmembrane Protein 3, beta-1,3-N-acetylglucosaminyltransferase 3, TMEM3, B3GN-T3, B3GNT-3, HP10328, B3GAL-T8, beta3Gn-T3) discontinued
209699-02 100 µL

B3GNT3 (Transmembrane Protein 3, beta-1,3-N-acetylglucosaminyltransferase 3, TMEM3, B3GN-T3, B3GNT-3, HP10328, B3GAL-T8, beta3Gn-T3) discontinued

Sign In for Pricing
View Details
B3GNT3 (Transmembrane Protein 3, beta-1,3-N-acetylglucosaminyltransferase 3, TMEM3, B3GN-T3, B3GNT-3, HP10328, B3GAL-T8, beta3Gn-T3) discontinued
209699-03 200 µL

B3GNT3 (Transmembrane Protein 3, beta-1,3-N-acetylglucosaminyltransferase 3, TMEM3, B3GN-T3, B3GNT-3, HP10328, B3GAL-T8, beta3Gn-T3) discontinued

Sign In for Pricing
View Details