Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Otoconin-90 (OC90), Biotinylated

This Recombinant Human Otoconin-90 (OC90), Biotinylated spans the amino acid sequence from region 18-477. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Otoconin-90; Oc90; Phospholipase A2 homolog; OC90 PLA2L

UniProt

Q02509

Expression Region

18-477

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

HPLDTPHLPQELPPGLPNNINITFFSGMFKNVESVAEIFDCLGPHFTWLQAVFTNFPVLIQFVNGMKCVAGLCPRDFEDYGCTCRFEMEGLPVDESDSCCFQHRRCYEEAAEMDCLQDPAKLSTEVNCVSKKIICESKDNCEHLLCTCDKAAIECLARSSLNSSLNLLDTSFCLAQTPETTIKEDLTTLLPRVVPVEPTDTSLTALSGEEAGHDQEGVGAARATSPPGSAEIVATRVTAKIVTLVPAGIKSLGLAVSSVENDPEETTEKACDRFTFLHLGSGDNMQVMPQLGEMLFCLTSRCPEEFESYGCYCGQEGRGEPRDDLDRCCLSHHCCLEQVRRLGCLLERLPWSPVVCVDHTPKCGGQSLCEKLLCACDQTAAECMTSASFNQSLKSPSRLGCPGQPAACEDSLHPVPAAPTLGSSSEEDSEEDPPQEDLGRAKRFLRKSLGPLGIGPLHGR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Glypican-3 Antibody Clone 1G12, Unconjugated-100ug
2719-MSM1-P1 100ug

Anti-Glypican-3 Antibody Clone 1G12, Unconjugated-100ug

Sign In for Pricing
View Details
YWHAE
339900-01 50 µL

YWHAE

Sign In for Pricing
View Details
YWHAE
339900-02 100 µL

YWHAE

Sign In for Pricing
View Details
Rabbit anti-TCFL5 Antibody
YLD7644-01 50 µL

Rabbit anti-TCFL5 Antibody

Sign In for Pricing
View Details
Rabbit anti-TCFL5 Antibody
YLD7644-02 100 µL

Rabbit anti-TCFL5 Antibody

Sign In for Pricing
View Details
Human Cytoglobin (CYGB) ELISA Kit
MBS458722-01 48 Tests

Human Cytoglobin (CYGB) ELISA Kit

Sign In for Pricing
View Details