Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Centrosomal protein of 170 kDa protein B (C170B), partial, Biotinylated

This Recombinant Human Centrosomal protein of 170 kDa protein B (C170B), partial, Biotinylated spans the amino acid sequence from region 23-73. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Centrosomal protein of 170 kDa protein B; Centrosomal protein 170B; Cep170B; CEP170B FAM68C KIAA0284

UniProt

Q9Y4F5

Expression Region

23-73

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

IFVGREECELMLQSRSVDKQHAVINYDQDRDEHWVKDLGSLNGTFVNDMRI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PCNAAS 3'UTR GFP Stable Cell Line
TU067572 1.0 mL

PCNAAS 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
DLRB1 rabbit pAb
ES9617-01 50 µL

DLRB1 rabbit pAb

Sign In for Pricing
View Details
DLRB1 rabbit pAb
ES9617-02 100 µL

DLRB1 rabbit pAb

Sign In for Pricing
View Details
MED7 cDNA Clone
MBS1276646-01 0.01 mg Plasmid + 0.2 mL Glycerol-Stock

MED7 cDNA Clone

Sign In for Pricing
View Details
MED7 cDNA Clone
MBS1276646-02 5x 0.01 mg Plasmid + 5x 0.2 mL Glycerol-Stock

MED7 cDNA Clone

Sign In for Pricing
View Details
Lentiviral human DCUN1D4 shRNA (UAS) - Lentiviral human DCUN1D4 shRNA (UAS, GFP) plasmid
GTR15310213 1 Vial

Lentiviral human DCUN1D4 shRNA (UAS) - Lentiviral human DCUN1D4 shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details