Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Tesmin (MTL5), Biotinylated

This Recombinant Human Tesmin (MTL5), Biotinylated spans the amino acid sequence from region 1-508. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Tesmin; Metallothionein-like 5, testis-specific; Testis-specific metallothionein-like protein; TESMIN MTL5

UniProt

Q9Y4I5

Expression Region

1-508

Origin

Homo sapiens (Human)

Field of Research

Stem Cell & Developmental Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MEEGPLPGGLPSPEDAMVTELLSPEGPFASENIGLKAPVKYEEDEFHVFKEAYLGPADPKEPVLHAFNPALGADCKGQVKAKLAGGDSDGGELLGEYPGIPELSALEDVALLQAPQPPACNVHFLSSLLPAHRSPAVLPLGAWVLEGASHPGVRMIPVEIKEAGGTTTSNNPEEATLQNLLAQESCCKFPSSQELEDASCCSLKKDSNPMVICQLKGGTQMLCIDNSRTRELKALHLVPQYQDQNNYLQSDVPKPMTALVGRFLPASTKLNLITQQLEGALPSVVNGSAFPSGSTLPGPPKITLAGYCDCFASGDFCNNCNCNNCCNNLHHDIERFKAIKACLGRNPEAFQPKIGKGQLGNVKPQHNKGCNCRRSGCLKNYCECYEAQIMCSSICKCIGCKNYEESPERKTLMSMPNYMQTGGLEGSHYLPPTKFSGLPRFSHDRRPSSCISWEVVEATCACLLAQGEEAEKEHCSKCLAEQMILEEFGRCLSQILHTEFKSKGLKME

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GRRP1 CRISPRa sgRNA lentivector (set of three targets)(Human)
22712121 3x 1.0µg DNA

GRRP1 CRISPRa sgRNA lentivector (set of three targets)(Human)

Sign In for Pricing
View Details
SOX12 (SRY (Sex Determining Region Y) -box 12, SOX-22 Protein, SRY (Sex Determining Region Y) -box 22, SRY-related HMG-box Gene 22, SOX22) (PE)
207891-PE 100 µL

SOX12 (SRY (Sex Determining Region Y) -box 12, SOX-22 Protein, SRY (Sex Determining Region Y) -box 22, SRY-related HMG-box Gene 22, SOX22) (PE)

Sign In for Pricing
View Details
Mouse DEPDC5 shRNA Plasmid
abx983178-01 150 µg

Mouse DEPDC5 shRNA Plasmid

Sign In for Pricing
View Details
Mouse DEPDC5 shRNA Plasmid
abx983178-02 300 µg

Mouse DEPDC5 shRNA Plasmid

Sign In for Pricing
View Details
Atp6v0a1 (NM_001243051) Mouse Untagged Clone
MC229027 10 µg

Atp6v0a1 (NM_001243051) Mouse Untagged Clone

Sign In for Pricing
View Details
Setd2-set siRNA/shRNA/RNAi Lentivector (Mouse)
43522094 4x 500 ng

Setd2-set siRNA/shRNA/RNAi Lentivector (Mouse)

Sign In for Pricing
View Details