Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 51B2 (O51B2), partial, Biotinylated

This Recombinant Human Olfactory receptor 51B2 (O51B2), partial, Biotinylated spans the amino acid sequence from region 159-194. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Olfactory receptor 51B2; Odorant receptor HOR5'beta3; Olfactory receptor 51B1; OR51B2 OR51B1P

UniProt

Q9Y5P1

Expression Region

159-194

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

LRLFSFSYCKSHVITRAFCLHQEIMRLACADITFNR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cathepsin H Antibody
KC-26087-01 50 μL

Cathepsin H Antibody

Sign In for Pricing
View Details
Cathepsin H Antibody
KC-26087-02 100 µL

Cathepsin H Antibody

Sign In for Pricing
View Details
Cathepsin H Antibody
KC-26087-03 1 mL

Cathepsin H Antibody

Sign In for Pricing
View Details
Myristic Acid
TRC-M884610-5G 5 g

Myristic Acid

Sign In for Pricing
View Details
Y14 (RBM8A) Mouse Monoclonal Antibody [Clone ID: OTI10B5]
CF812498 100 µg

Y14 (RBM8A) Mouse Monoclonal Antibody [Clone ID: OTI10B5]

Sign In for Pricing
View Details
NMNAT1 (NM_001297779) Human Tagged ORF Clone
RG236175 10 µg

NMNAT1 (NM_001297779) Human Tagged ORF Clone

Sign In for Pricing
View Details