Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Probable non-functional immunoglobulin kappa variable 1D-42 (KVD42), Biotinylated

This Recombinant Human Probable non-functional immunoglobulin kappa variable 1D-42 (KVD42), Biotinylated spans the amino acid sequence from region 23-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Probable non-functional immunoglobulin kappa variable 1D-42 IGKV1D-42

UniProt

A0A075B6H8

Expression Region

23-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

DIQMTQSPSFLSASVGDRVSIICWASEGISSNLAWYLQKPGKSPKLFLYDAKDLHPGVSSRFSGRGSGTDFTLTIISLKPEDFAAYYCKQDFSYP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fura -2 K+ Salt - calcium indicator
1052B 1 mg

Fura -2 K+ Salt - calcium indicator

Sign In for Pricing
View Details
Tissue Total RNA, Ovary: right
CR562959 5 µg

Tissue Total RNA, Ovary: right

Sign In for Pricing
View Details
NME6 (N-term) Rabbit Polyclonal Antibody
AP15031PU-N 400 µL

NME6 (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human TBC1D9B activation kit by CRISPRa
GA108007 1 Kit

Human TBC1D9B activation kit by CRISPRa

Sign In for Pricing
View Details
MET Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1A8]
TA805996BM 100 µL

MET Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1A8]

Sign In for Pricing
View Details
Tecrl Mouse Gene Knockout Kit (CRISPR)
KN517391 1 Kit

Tecrl Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details