Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Probable non-functional immunoglobulin kappa variable 1D-42 (KVD42), Biotinylated

This Recombinant Human Probable non-functional immunoglobulin kappa variable 1D-42 (KVD42), Biotinylated spans the amino acid sequence from region 23-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Probable non-functional immunoglobulin kappa variable 1D-42 IGKV1D-42

UniProt

A0A075B6H8

Expression Region

23-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

DIQMTQSPSFLSASVGDRVSIICWASEGISSNLAWYLQKPGKSPKLFLYDAKDLHPGVSSRFSGRGSGTDFTLTIISLKPEDFAAYYCKQDFSYP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rapid Hamster Monoclonal Antibody Isotyping Kit
ISO-HAM-20 20 tests

Rapid Hamster Monoclonal Antibody Isotyping Kit

Sign In for Pricing
View Details
KCNT1 siRNA (m)
sc-146373 10 µM

KCNT1 siRNA (m)

Sign In for Pricing
View Details
B4GALT2 Rabbit pAb
E45R23804N 50 ul

B4GALT2 Rabbit pAb

Sign In for Pricing
View Details
NFS1 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-C-term-HA)
LV694088 1.0 µg DNA

NFS1 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-C-term-HA)

Sign In for Pricing
View Details
MRPS34 Protein Vector (Mouse) (pPB-N-His)
PV202259 500 ng

MRPS34 Protein Vector (Mouse) (pPB-N-His)

Sign In for Pricing
View Details
Human CD2 Alexa Fluor 405 MAb (299808)
FAB18562V-100UG 100 µg

Human CD2 Alexa Fluor 405 MAb (299808)

Sign In for Pricing
View Details