Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin lambda variable 8-61 (LV861), Biotinylated

This Recombinant Human Immunoglobulin lambda variable 8-61 (LV861), Biotinylated spans the amino acid sequence from region 25-122. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin lambda variable 8-61 IGLV8-61

UniProt

A0A075B6I0

Expression Region

25-122

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QTVVTQEPSFSVSPGGTVTLTCGLSSGSVSTSYYPSWYQQTPGQAPRTLIYSTNTRSSGVPDRFSGSILGNKAALTITGAQADDESDYYCVLYMGSGI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Crucible, Stainless Steel
2062910 1 Each

Crucible, Stainless Steel

Sign In for Pricing
View Details
FAM114A1 Protein Vector (Human) (pPM-C-HA)
PV015019 500 ng

FAM114A1 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
Rabbit Polyclonal Nestin Antibody [DyLight 350]
NB300-265UV 0.1 mL

Rabbit Polyclonal Nestin Antibody [DyLight 350]

Sign In for Pricing
View Details
Mouse 4930444M15Rik activation kit by CRISPRa
GA210354 1 Kit

Mouse 4930444M15Rik activation kit by CRISPRa

Sign In for Pricing
View Details
ACTR2 (Actin-related Protein 2, Actin-like Protein 2, ARP2) (PE)
MBS6399458-01 0.1 mL

ACTR2 (Actin-related Protein 2, Actin-like Protein 2, ARP2) (PE)

Sign In for Pricing
View Details
ACTR2 (Actin-related Protein 2, Actin-like Protein 2, ARP2) (PE)
MBS6399458-02 5x 0.1 mL

ACTR2 (Actin-related Protein 2, Actin-like Protein 2, ARP2) (PE)

Sign In for Pricing
View Details