Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin lambda variable 4-60 (LV460), Biotinylated

This Recombinant Human Immunoglobulin lambda variable 4-60 (LV460), Biotinylated spans the amino acid sequence from region 22-120. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin lambda variable 4-60 IGLV4-60

UniProt

A0A075B6I1

Expression Region

22-120

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QPVLTQSSSASASLGSSVKLTCTLSSGHSSYIIAWHQQQPGKAPRYLMKLEGSGSYNKGSGVPDRFSGSSSGADRYLTISNLQFEDEADYYCETWDSNT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Gtse1 shRNA (UAS) - Lentiviral mouse Gtse1 shRNA (UAS) plasmid
GTR15185071 1 Vial

Lentiviral mouse Gtse1 shRNA (UAS) - Lentiviral mouse Gtse1 shRNA (UAS) plasmid

Sign In for Pricing
View Details
Rabbit Synaptojanin 2 Antibody
orb1523853-01 10 µL

Rabbit Synaptojanin 2 Antibody

Sign In for Pricing
View Details
Rabbit Synaptojanin 2 Antibody
orb1523853-02 100 µL

Rabbit Synaptojanin 2 Antibody

Sign In for Pricing
View Details
RPS18P3 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA)
LV783690 1.0 µg DNA

RPS18P3 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA)

Sign In for Pricing
View Details
HMGN5, NT (HMGN5, NSBP1, High mobility group nucleosome-binding domain-containing protein 5, Nucleosome-binding protein 1) (MaxLight 405)
MBS6307357-01 0.1 mL

HMGN5, NT (HMGN5, NSBP1, High mobility group nucleosome-binding domain-containing protein 5, Nucleosome-binding protein 1) (MaxLight 405)

Sign In for Pricing
View Details
HMGN5, NT (HMGN5, NSBP1, High mobility group nucleosome-binding domain-containing protein 5, Nucleosome-binding protein 1) (MaxLight 405)
MBS6307357-02 5x 0.1 mL

HMGN5, NT (HMGN5, NSBP1, High mobility group nucleosome-binding domain-containing protein 5, Nucleosome-binding protein 1) (MaxLight 405)

Sign In for Pricing
View Details