Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Probable non-functional immunoglobulin lambda variable 11-55 (LVK55), Biotinylated

This Recombinant Human Probable non-functional immunoglobulin lambda variable 11-55 (LVK55), Biotinylated spans the amino acid sequence from region 20-123. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Probable non-functional immunoglobulin lambda variable 11-55 IGLV11-55

UniProt

A0A075B6I3

Expression Region

20-123

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

RPVLTQPPSLSASPGATARLPCTLSSDLSVGGKNMFWYQQKLGSSPRLFLYHYSDSDKQLGPGVPSRVSGSKETSSNTAFLLISGLQPEDEADYYCQVYESSAN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CHCHD7 Antibody
orb677429 100 µL

CHCHD7 Antibody

Sign In for Pricing
View Details
Lentiviral mouse Pomgnt1 shRNA (UAS) - Lentiviral mouse Pomgnt1 shRNA (UAS, RFP) (100)
GTR15238632 1 Vial

Lentiviral mouse Pomgnt1 shRNA (UAS) - Lentiviral mouse Pomgnt1 shRNA (UAS, RFP) (100)

Sign In for Pricing
View Details
Itgb3 Antibody
orb1272066 0.1 mg

Itgb3 Antibody

Sign In for Pricing
View Details
Lentiviral human IKZF2 shRNA (UAS) - Lentiviral human IKZF2 shRNA (UAS, GFP) plasmid
GTR15082966 1 Vial

Lentiviral human IKZF2 shRNA (UAS) - Lentiviral human IKZF2 shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details
NKX3-1 Protein Vector (Mouse) (pPM-C-His)
PV205693 500 ng

NKX3-1 Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details
TLR7 (Toll-like Receptor 7) (PE)
MBS6185508-01 0.1 mL

TLR7 (Toll-like Receptor 7) (PE)

Sign In for Pricing
View Details