Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Probable non-functional immunoglobulin lambda variable 11-55 (LVK55), Biotinylated

This Recombinant Human Probable non-functional immunoglobulin lambda variable 11-55 (LVK55), Biotinylated spans the amino acid sequence from region 20-123. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Probable non-functional immunoglobulin lambda variable 11-55 IGLV11-55

UniProt

A0A075B6I3

Expression Region

20-123

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

RPVLTQPPSLSASPGATARLPCTLSSDLSVGGKNMFWYQQKLGSSPRLFLYHYSDSDKQLGPGVPSRVSGSKETSSNTAFLLISGLQPEDEADYYCQVYESSAN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NDRG3 siRNA (Rat)
orb1829458-01 15 nmol

NDRG3 siRNA (Rat)

Sign In for Pricing
View Details
NDRG3 siRNA (Rat)
orb1829458-02 30 nmol

NDRG3 siRNA (Rat)

Sign In for Pricing
View Details
ELOVL4 siRNA (Human)
CRH4641-01 15 nmol

ELOVL4 siRNA (Human)

Sign In for Pricing
View Details
ELOVL4 siRNA (Human)
CRH4641-02 30 nmol

ELOVL4 siRNA (Human)

Sign In for Pricing
View Details
Rat LZM (Lysozyme) ELISA Kit
MBS8806343-01 48 Strip Well

Rat LZM (Lysozyme) ELISA Kit

Sign In for Pricing
View Details
Rat LZM (Lysozyme) ELISA Kit
MBS8806343-02 96 Strip Well

Rat LZM (Lysozyme) ELISA Kit

Sign In for Pricing
View Details