Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Probable non-functional immunoglobulin lambda variable 11-55 (LVK55), Biotinylated

This Recombinant Human Probable non-functional immunoglobulin lambda variable 11-55 (LVK55), Biotinylated spans the amino acid sequence from region 20-123. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Probable non-functional immunoglobulin lambda variable 11-55 IGLV11-55

UniProt

A0A075B6I3

Expression Region

20-123

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

RPVLTQPPSLSASPGATARLPCTLSSDLSVGGKNMFWYQQKLGSSPRLFLYHYSDSDKQLGPGVPSRVSGSKETSSNTAFLLISGLQPEDEADYYCQVYESSAN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal ZMPSTE24 Antibody [mFluor Violet 610 SE]
NB100-2388MFV610 0.1 mL

Rabbit Polyclonal ZMPSTE24 Antibody [mFluor Violet 610 SE]

Sign In for Pricing
View Details
Anti-HLA-DQB1 Antibody Picoband® (iFluor647 Conjugate)
A00106-1-iFluor647 100 µg

Anti-HLA-DQB1 Antibody Picoband® (iFluor647 Conjugate)

Sign In for Pricing
View Details
Csf1r Protein (C-His, Mouse)
P514517 100 µg

Csf1r Protein (C-His, Mouse)

Sign In for Pricing
View Details
Cluster of Differentiation 3 (CD3) Antibody
abx414989 500 µg

Cluster of Differentiation 3 (CD3) Antibody

Sign In for Pricing
View Details
Human Liver Ferritin WB +ve protein control
FERT17-C 100 µL

Human Liver Ferritin WB +ve protein control

Sign In for Pricing
View Details
Menin (MEN1) (NM_130799) Human Untagged Clone
SC109429 10 µg

Menin (MEN1) (NM_130799) Human Untagged Clone

Sign In for Pricing
View Details