Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin lambda variable 10-54 (LVX54), Biotinylated

This Recombinant Human Immunoglobulin lambda variable 10-54 (LVX54), Biotinylated spans the amino acid sequence from region 22-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin lambda variable 10-54 IGLV10-54

UniProt

A0A075B6I4

Expression Region

22-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GLTQPPSVSKGLRQTATLTCTGNSNIVGNQGAAWLQQHQGHPPKLLSYRNNNRPSGISERFSASRSGNTASLTITGLQPEDEADYYCSALDSSLSA

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

XKR9 shRNA (h) Lentiviral Particles
sc-77565-V 200 µL

XKR9 shRNA (h) Lentiviral Particles

Sign In for Pricing
View Details
Rabbit Polyclonal CBP/KAT3A Antibody [PE]
NBP2-98753PE 0.1 mL

Rabbit Polyclonal CBP/KAT3A Antibody [PE]

Sign In for Pricing
View Details
GIRK2 Peptide
DF14400-BP 1 mg

GIRK2 Peptide

Sign In for Pricing
View Details
CRNN Polyclonal Antibody
JOT-AP08120-01 50ul

CRNN Polyclonal Antibody

Sign In for Pricing
View Details
CRNN Polyclonal Antibody
JOT-AP08120-02 100ul

CRNN Polyclonal Antibody

Sign In for Pricing
View Details
ERK1/2 (Y204) polyclonal antibody
E43P0049 100 µL

ERK1/2 (Y204) polyclonal antibody

Sign In for Pricing
View Details