Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin lambda variable 10-54 (LVX54), Biotinylated

This Recombinant Human Immunoglobulin lambda variable 10-54 (LVX54), Biotinylated spans the amino acid sequence from region 22-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin lambda variable 10-54 IGLV10-54

UniProt

A0A075B6I4

Expression Region

22-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GLTQPPSVSKGLRQTATLTCTGNSNIVGNQGAAWLQQHQGHPPKLLSYRNNNRPSGISERFSASRSGNTASLTITGLQPEDEADYYCSALDSSLSA

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

PNMT Antibody
orb1323327 100 µL

PNMT Antibody

Sign In for Pricing
View Details
Urethra of rabbit, t.s.
Ma423c 7.6 x 2.6 cm

Urethra of rabbit, t.s.

Sign In for Pricing
View Details
Gab3 (NM_181584) Mouse Untagged Clone
MC219560 10 µg

Gab3 (NM_181584) Mouse Untagged Clone

Sign In for Pricing
View Details
NMB Antibody
MBS9419482-01 0.05 mL

NMB Antibody

Sign In for Pricing
View Details
NMB Antibody
MBS9419482-02 0.1 mL

NMB Antibody

Sign In for Pricing
View Details
NMB Antibody
MBS9419482-03 5x 0.1 mL

NMB Antibody

Sign In for Pricing
View Details