Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin lambda variable 5-37 (LV537), Biotinylated

This Recombinant Human Immunoglobulin lambda variable 5-37 (LV537), Biotinylated spans the amino acid sequence from region 20-123. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin lambda variable 5-37 IGLV5-37

UniProt

A0A075B6J1

Expression Region

20-123

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QPVLTQPPSSSASPGESARLTCTLPSDINVGSYNIYWYQQKPGSPPRYLLYYYSDSDKGQGSGVPSRFSGSKDASANTGILLISGLQSEDEADYYCMIWPSNAS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human PINK1 sgRNA gene knockout kit - Lentiviral human PINK1 sgRNA gene knockout kit (25)
GTR15361944 1 Vial

Lentiviral human PINK1 sgRNA gene knockout kit - Lentiviral human PINK1 sgRNA gene knockout kit (25)

Sign In for Pricing
View Details
Mouse Monoclonal GPR15 Antibody (367902) [Janelia Fluor 525]
FAB3654JF525 0.1 mL

Mouse Monoclonal GPR15 Antibody (367902) [Janelia Fluor 525]

Sign In for Pricing
View Details
Lrwd1-set siRNA/shRNA/RNAi Lentivector (Mouse)
27730094 4x 500 ng

Lrwd1-set siRNA/shRNA/RNAi Lentivector (Mouse)

Sign In for Pricing
View Details
EEF1A1 Recombinant Protein (Mouse)
RP130895 100 µg

EEF1A1 Recombinant Protein (Mouse)

Sign In for Pricing
View Details
Sp100 ORF Vector (Rat) (pORF)
45156016 1.0 µg DNA

Sp100 ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details
Regulator Of G Protein Signaling 1 (RGS1) Magnetic Luminex Assay Kit
LKU603345 96 Tests

Regulator Of G Protein Signaling 1 (RGS1) Magnetic Luminex Assay Kit

Sign In for Pricing
View Details