Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin lambda variable 3-22 (LV322), Biotinylated

This Recombinant Human Immunoglobulin lambda variable 3-22 (LV322), Biotinylated spans the amino acid sequence from region 21-115. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin lambda variable 3-22 IGLV3-22

UniProt

A0A075B6J6

Expression Region

21-115

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

YELTQLPSVSVSPGQTARITCSGDVLGENYADWYQQKPGQAPELVIYEDSERYPGIPERFSGSTSGNTTTLTISRVLTEDEADYYCLSGDEDNPS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Flavin Containing Monooxygenase 1 (FMO1) ELISA Kit
DLR-FMO1-Hu-96T 96 Tests

Human Flavin Containing Monooxygenase 1 (FMO1) ELISA Kit

Sign In for Pricing
View Details
TH-287 hydrochloride
MBS3602473-01 2 mg

TH-287 hydrochloride

Sign In for Pricing
View Details
TH-287 hydrochloride
MBS3602473-02 5 mg

TH-287 hydrochloride

Sign In for Pricing
View Details
TH-287 hydrochloride
MBS3602473-03 10 mg

TH-287 hydrochloride

Sign In for Pricing
View Details
TH-287 hydrochloride
MBS3602473-04 25 mg

TH-287 hydrochloride

Sign In for Pricing
View Details
TH-287 hydrochloride
MBS3602473-05 50 mg

TH-287 hydrochloride

Sign In for Pricing
View Details