Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin lambda variable 2-18 (LV218), Biotinylated

This Recombinant Human Immunoglobulin lambda variable 2-18 (LV218), Biotinylated spans the amino acid sequence from region 20-118. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin lambda variable 2-18 IGLV2-18

UniProt

A0A075B6J9

Expression Region

20-118

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QSALTQPPSVSGSPGQSVTISCTGTSSDVGSYNRVSWYQQPPGTAPKLMIYEVSNRPSGVPDRFSGSKSGNTASLTISGLQAEDEADYYCSLYTSSSTF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human D-beta-hydroxybutyrate dehydrogenase, mitochondrial (BDH1)
orb3156112-01 20 µg

Recombinant Human D-beta-hydroxybutyrate dehydrogenase, mitochondrial (BDH1)

Sign In for Pricing
View Details
Recombinant Human D-beta-hydroxybutyrate dehydrogenase, mitochondrial (BDH1)
orb3156112-02 100 µg

Recombinant Human D-beta-hydroxybutyrate dehydrogenase, mitochondrial (BDH1)

Sign In for Pricing
View Details
Recombinant Human D-beta-hydroxybutyrate dehydrogenase, mitochondrial (BDH1)
orb3156112-03 1 mg

Recombinant Human D-beta-hydroxybutyrate dehydrogenase, mitochondrial (BDH1)

Sign In for Pricing
View Details
Vmn2r40 Protein Vector (Mouse) (pPM-C-His)
PV246205 500 ng

Vmn2r40 Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details
TUG-1375
XPD37259-01 5 mg

TUG-1375

Sign In for Pricing
View Details
TUG-1375
XPD37259-02 10 mg

TUG-1375

Sign In for Pricing
View Details