Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin lambda variable 3-16 (LV316), Biotinylated

This Recombinant Human Immunoglobulin lambda variable 3-16 (LV316), Biotinylated spans the amino acid sequence from region 20-115. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin lambda variable 3-16 IGLV3-16

UniProt

A0A075B6K0

Expression Region

20-115

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

SYELTQPPSVSVSLGQMARITCSGEALPKKYAYWYQQKPGQFPVLVIYKDSERPSGIPERFSGSSSGTIVTLTISGVQAEDEADYYCLSADSSGTY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

(5-Chloro-2-fluoro-3-iodophenyl) (methyl) sulfane
PC1024696-01 250 mg

(5-Chloro-2-fluoro-3-iodophenyl) (methyl) sulfane

Sign In for Pricing
View Details
(5-Chloro-2-fluoro-3-iodophenyl) (methyl) sulfane
PC1024696-02 500 mg

(5-Chloro-2-fluoro-3-iodophenyl) (methyl) sulfane

Sign In for Pricing
View Details
(5-Chloro-2-fluoro-3-iodophenyl) (methyl) sulfane
PC1024696-03 1 g

(5-Chloro-2-fluoro-3-iodophenyl) (methyl) sulfane

Sign In for Pricing
View Details
(5-Chloro-2-fluoro-3-iodophenyl) (methyl) sulfane
PC1024696-04 5 g

(5-Chloro-2-fluoro-3-iodophenyl) (methyl) sulfane

Sign In for Pricing
View Details
(5-Chloro-2-fluoro-3-iodophenyl) (methyl) sulfane
PC1024696-05 10 g

(5-Chloro-2-fluoro-3-iodophenyl) (methyl) sulfane

Sign In for Pricing
View Details
FAM83E (NM_017708) Human Tagged Lenti ORF Clone
RC211287L4 10 µg

FAM83E (NM_017708) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details