Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin lambda variable 3-16 (LV316), Biotinylated

This Recombinant Human Immunoglobulin lambda variable 3-16 (LV316), Biotinylated spans the amino acid sequence from region 20-115. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin lambda variable 3-16 IGLV3-16

UniProt

A0A075B6K0

Expression Region

20-115

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

SYELTQPPSVSVSLGQMARITCSGEALPKKYAYWYQQKPGQFPVLVIYKDSERPSGIPERFSGSSSGTIVTLTISGVQAEDEADYYCLSADSSGTY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TFRC Recombinant Antibody, Cy5.5 Conjugated
bsm-52793R-Cy5.5 100 µL

TFRC Recombinant Antibody, Cy5.5 Conjugated

Sign In for Pricing
View Details
Recombinant Human Palmitoyl-Protein Thioesterase 1/PPT1 (C-6His)
orb1648863-01 10 µg

Recombinant Human Palmitoyl-Protein Thioesterase 1/PPT1 (C-6His)

Sign In for Pricing
View Details
Recombinant Human Palmitoyl-Protein Thioesterase 1/PPT1 (C-6His)
orb1648863-02 50 µg

Recombinant Human Palmitoyl-Protein Thioesterase 1/PPT1 (C-6His)

Sign In for Pricing
View Details
Recombinant Human Palmitoyl-Protein Thioesterase 1/PPT1 (C-6His)
orb1648863-03 500 µg

Recombinant Human Palmitoyl-Protein Thioesterase 1/PPT1 (C-6His)

Sign In for Pricing
View Details
Recombinant Human Palmitoyl-Protein Thioesterase 1/PPT1 (C-6His)
orb1648863-04 1 mg

Recombinant Human Palmitoyl-Protein Thioesterase 1/PPT1 (C-6His)

Sign In for Pricing
View Details
Human Trefoil Factor 1 (TFF1) Protein
abx262086-01 5 µg

Human Trefoil Factor 1 (TFF1) Protein

Sign In for Pricing
View Details