Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin lambda variable 3-10 (LV310), Biotinylated

This Recombinant Human Immunoglobulin lambda variable 3-10 (LV310), Biotinylated spans the amino acid sequence from region 20-115. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin lambda variable 3-10 IGLV3-10

UniProt

A0A075B6K4

Expression Region

20-115

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

SYELTQPPSVSVSPGQTARITCSGDALPKKYAYWYQQKSGQAPVLVIYEDSKRPSGIPERFSGSSSGTMATLTISGAQVEDEADYYCYSTDSSGNH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GPR146 (G Protein-Coupled Receptor 146, PGR8) (PE)
MBS6451046-01 0.1 mL

GPR146 (G Protein-Coupled Receptor 146, PGR8) (PE)

Sign In for Pricing
View Details
GPR146 (G Protein-Coupled Receptor 146, PGR8) (PE)
MBS6451046-02 5x 0.1 mL

GPR146 (G Protein-Coupled Receptor 146, PGR8) (PE)

Sign In for Pricing
View Details
C10orf84 Rabbit Polyclonal Antibody
orb513218 100 µg

C10orf84 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human Apc11 (ANAPC11) (NM_001289417) AAV Particle
RC235522A1V 250 µL

Human Apc11 (ANAPC11) (NM_001289417) AAV Particle

Sign In for Pricing
View Details
2510049J12Rik AAV siRNA Pooled Vector
10451164 1.0 µg

2510049J12Rik AAV siRNA Pooled Vector

Sign In for Pricing
View Details
DOK5 Antibody
GWB-MP184D 50 µg

DOK5 Antibody

Sign In for Pricing
View Details