Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin lambda variable 3-10 (LV310), Biotinylated

This Recombinant Human Immunoglobulin lambda variable 3-10 (LV310), Biotinylated spans the amino acid sequence from region 20-115. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin lambda variable 3-10 IGLV3-10

UniProt

A0A075B6K4

Expression Region

20-115

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

SYELTQPPSVSVSPGQTARITCSGDALPKKYAYWYQQKSGQAPVLVIYEDSKRPSGIPERFSGSSSGTMATLTISGAQVEDEADYYCYSTDSSGNH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ceapin-A7 10mg
A22001-10 10 mg

Ceapin-A7 10mg

Sign In for Pricing
View Details
Label Roll, Cryo, Direct Thermal,38x19mm
LTC-38X19Y 750/Roll

Label Roll, Cryo, Direct Thermal,38x19mm

Sign In for Pricing
View Details
FAM76B 3'UTR GFP Stable Cell Line
TU057410 1.0 mL

FAM76B 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Human LRIG2 MAb (Clone 990310)
MAB1941-SP 25 µg

Human LRIG2 MAb (Clone 990310)

Sign In for Pricing
View Details
Recombinant Human Poliovirus receptor-related protein 1 (PVRL1), partial
MBS1347797-01 0.5 mg (E-Coli)

Recombinant Human Poliovirus receptor-related protein 1 (PVRL1), partial

Sign In for Pricing
View Details
Recombinant Human Poliovirus receptor-related protein 1 (PVRL1), partial
MBS1347797-02 0.05 mg (Baculovirus)

Recombinant Human Poliovirus receptor-related protein 1 (PVRL1), partial

Sign In for Pricing
View Details