Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 20-1 (TVBT1), Biotinylated

This Recombinant Human T cell receptor beta variable 20-1 (TVBT1), Biotinylated spans the amino acid sequence from region 16-111. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 20-1 TRBV20-1

UniProt

A0A075B6N2

Expression Region

16-111

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

AVVSQHPSRVICKSGTSVKIECRSLDFQATTMFWYRQFPKQSLMLMATSNEGSKATYEQGVEKDKFLINHASLTLSTLTVTSAHPEDSSFYICSAR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Double Stranded DNA (dsDNA) (DSD/958), CF568 conjugate, 0.1mg/mL
BNC680958-500 1x 500 µL

Double Stranded DNA (dsDNA) (DSD/958), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
UBA5 Rabbit Polyclonal Antibody
orb1291707 100 µg

UBA5 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Phospho-Histone H3 (Thr11) Polyclonal Antibody
bs-60070R 100 µL

Phospho-Histone H3 (Thr11) Polyclonal Antibody

Sign In for Pricing
View Details
Cystatin A Overexpression Lysate (Native) - (Dry Ice)
NBL1-09553 0.1 mg

Cystatin A Overexpression Lysate (Native) - (Dry Ice)

Sign In for Pricing
View Details
Chicken Replication factor C subunit 2 (RFC2) ELISA Kit
MBS7244409-01 48 Well

Chicken Replication factor C subunit 2 (RFC2) ELISA Kit

Sign In for Pricing
View Details
Chicken Replication factor C subunit 2 (RFC2) ELISA Kit
MBS7244409-02 96 Well

Chicken Replication factor C subunit 2 (RFC2) ELISA Kit

Sign In for Pricing
View Details