Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 24-1 (TVBX1), Biotinylated

This Recombinant Human T cell receptor beta variable 24-1 (TVBX1), Biotinylated spans the amino acid sequence from region 22-115. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 24-1 TRBV24-1

UniProt

A0A075B6N3

Expression Region

22-115

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

DVTQTPRNRITKTGKRIMLECSQTKGHDRMYWYRQDPGLGLQLIYYSFDVKDINKGEISDGYSVSRQAQAKFSLSLESAIPNQTALYFCATSDL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SF3B3
CSB-CL614890HU2 10 μg Plasmid + 200 μL Glycerol

SF3B3

Sign In for Pricing
View Details
Recombinant Chlamydia psittaci dnaK/HSP70 Protein, N-His
E55P3694 50 µg

Recombinant Chlamydia psittaci dnaK/HSP70 Protein, N-His

Sign In for Pricing
View Details
ART3 Polyclonal Antibody, AbBy Fluor™ 350 Conjugated
bs-9103R-BF350 100 µL

ART3 Polyclonal Antibody, AbBy Fluor™ 350 Conjugated

Sign In for Pricing
View Details
Human PCK1 ELISA Kit
E029051 1 Each

Human PCK1 ELISA Kit

Sign In for Pricing
View Details
Porcine Pancreatic Ductal Epithelial Primary Cells
CC7F865 5x 10^5 Cells/Vial

Porcine Pancreatic Ductal Epithelial Primary Cells

Sign In for Pricing
View Details
Mouse Monoclonal ASC/TMS1 Antibody (OTI3E9) [Alexa Fluor 594]
NBP2-71853AF594 0.1 mL

Mouse Monoclonal ASC/TMS1 Antibody (OTI3E9) [Alexa Fluor 594]

Sign In for Pricing
View Details