Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 24-1 (TVBX1), Biotinylated

This Recombinant Human T cell receptor beta variable 24-1 (TVBX1), Biotinylated spans the amino acid sequence from region 22-115. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 24-1 TRBV24-1

UniProt

A0A075B6N3

Expression Region

22-115

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

DVTQTPRNRITKTGKRIMLECSQTKGHDRMYWYRQDPGLGLQLIYYSFDVKDINKGEISDGYSVSRQAQAKFSLSLESAIPNQTALYFCATSDL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DNAJC9 Antibody - C-terminal region
ARP62539_P050-25UL 25 µL

DNAJC9 Antibody - C-terminal region

Sign In for Pricing
View Details
CRCP Recombinant Antibody, PE Conjugated
bsm-62756R-PE-TR 20 µL

CRCP Recombinant Antibody, PE Conjugated

Sign In for Pricing
View Details
Lentiviral mouse Slc30a9 shRNA (UAS) - Lentiviral mouse Slc30a9 shRNA (UAS, GFP) plasmid
GTR15211390 1 Vial

Lentiviral mouse Slc30a9 shRNA (UAS) - Lentiviral mouse Slc30a9 shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details
IBD VP3 Matched Antibody Pair Set [ABP-S-07694]
ABP-S-07694 5 Plates

IBD VP3 Matched Antibody Pair Set [ABP-S-07694]

Sign In for Pricing
View Details
Rat rno-miR-6325 miRNA Antagomir
abx890444-01 10 nmol

Rat rno-miR-6325 miRNA Antagomir

Sign In for Pricing
View Details
Rat rno-miR-6325 miRNA Antagomir
abx890444-02 20 nmol

Rat rno-miR-6325 miRNA Antagomir

Sign In for Pricing
View Details