Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 24-1 (TVBX1), Biotinylated

This Recombinant Human T cell receptor beta variable 24-1 (TVBX1), Biotinylated spans the amino acid sequence from region 22-115. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 24-1 TRBV24-1

UniProt

A0A075B6N3

Expression Region

22-115

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

DVTQTPRNRITKTGKRIMLECSQTKGHDRMYWYRQDPGLGLQLIYYSFDVKDINKGEISDGYSVSRQAQAKFSLSLESAIPNQTALYFCATSDL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rab5c ORF Vector (Rat) (pORF)
38356016 1.0 µg DNA

Rab5c ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details
Mouse Sema3c (NM_013657) AAV Particle
MR210467A1V 250 µL

Mouse Sema3c (NM_013657) AAV Particle

Sign In for Pricing
View Details
Human IL-17A ELISA Discovery
M850940048 48 Well

Human IL-17A ELISA Discovery

Sign In for Pricing
View Details
APCS Protein Vector (Rat) (pPM-C-His)
PV253993 500 ng

APCS Protein Vector (Rat) (pPM-C-His)

Sign In for Pricing
View Details
Recombinant Human STARD10 Protein - (Dry Ice)
H00010809-P01-25ug 25 µg

Recombinant Human STARD10 Protein - (Dry Ice)

Sign In for Pricing
View Details
CD19 Recombinant Rabbit Monoclonal Antibody [JF099-9]
ET1702-74 100 µL

CD19 Recombinant Rabbit Monoclonal Antibody [JF099-9]

Sign In for Pricing
View Details