Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 25-1 (TVBY1), Biotinylated

This Recombinant Human T cell receptor beta variable 25-1 (TVBY1), Biotinylated spans the amino acid sequence from region 22-114. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 25-1 TRBV25-1

UniProt

A0A075B6N4

Expression Region

22-114

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

DIYQTPRYLVIGTGKKITLECSQTMGHDKMYWYQQDPGMELHLIHYSYGVNSTEKGDLSSESTVSRIRTEHFPLTLESARPSHTSQYLCASSE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Forget-Me-NotTM EvaGreen® qPCR Master Mix (Low ROX) (1000 reactions)
#31045-10mL 1x 10 mL

Forget-Me-NotTM EvaGreen® qPCR Master Mix (Low ROX) (1000 reactions)

Sign In for Pricing
View Details
N-Nitroso-(-)-ephedrine
TRC-B395770-100MG 100 mg

N-Nitroso-(-)-ephedrine

Sign In for Pricing
View Details
TBX3 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3B1]
TA811270AM 100 µL

TBX3 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3B1]

Sign In for Pricing
View Details
(2S,3S)-2,3-Oxiranedicarboxylic Acid Monoethyl Ester
TRC-O846925-10MG 10 mg

(2S,3S)-2,3-Oxiranedicarboxylic Acid Monoethyl Ester

Sign In for Pricing
View Details
C1QB / Complement C1q B-Chain (C1QB/2961), CF640R conjugate, 0.1mg/mL
BNC402961-500 1x 500 µL

C1QB / Complement C1q B-Chain (C1QB/2961), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PEG10 (NM_001184962) Human Over-expression Lysate
LC432935 20 µg

PEG10 (NM_001184962) Human Over-expression Lysate

Sign In for Pricing
View Details