Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 3-64 (HV364), Biotinylated

This Recombinant Human Immunoglobulin heavy variable 3-64 (HV364), Biotinylated spans the amino acid sequence from region 21-118. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 3-64 IGHV3-64

UniProt

A0A075B6Q5

Expression Region

21-118

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EVQLVESGEGLVQPGGSLRLSCAASGFTFSSYAMHWVRQAPGKGLEYVSAISSNGGSTYYADSVKGRFTISRDNSKNTLYLQMGSLRAEDMAVYYCAR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Dendrobine
TRC-D231445-10MG 10 mg

Dendrobine

Sign In for Pricing
View Details
ERCC8 (Center) Rabbit Polyclonal Antibody
AP51450PU-N 400 µL

ERCC8 (Center) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human mTOR (Mammalian Target of Rapamycin) ELISA Kit
E-EL-H1655-01 24 Tests

Human mTOR (Mammalian Target of Rapamycin) ELISA Kit

Sign In for Pricing
View Details
Human mTOR (Mammalian Target of Rapamycin) ELISA Kit
E-EL-H1655-02 48 Tests

Human mTOR (Mammalian Target of Rapamycin) ELISA Kit

Sign In for Pricing
View Details
Human mTOR (Mammalian Target of Rapamycin) ELISA Kit
E-EL-H1655-03 96 Tests

Human mTOR (Mammalian Target of Rapamycin) ELISA Kit

Sign In for Pricing
View Details
Human EEF1A2 activation kit by CRISPRa
GA101335 1 Kit

Human EEF1A2 activation kit by CRISPRa

Sign In for Pricing
View Details