Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 3-64 (HV364), Biotinylated

This Recombinant Human Immunoglobulin heavy variable 3-64 (HV364), Biotinylated spans the amino acid sequence from region 21-118. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 3-64 IGHV3-64

UniProt

A0A075B6Q5

Expression Region

21-118

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EVQLVESGEGLVQPGGSLRLSCAASGFTFSSYAMHWVRQAPGKGLEYVSAISSNGGSTYYADSVKGRFTISRDNSKNTLYLQMGSLRAEDMAVYYCAR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TJP1 Human Gene Knockout Kit (CRISPR)
KN216224 1 Kit

TJP1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
ANGPTL1 (NM_004673) Human Over-expression Lysate
LY401482 100 µg

ANGPTL1 (NM_004673) Human Over-expression Lysate

Sign In for Pricing
View Details
COG2 Rabbit Polyclonal Antibody
TA365670 100 µL

COG2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Tissue FFPE Sections, Peritoneum
CS704194 5x 5 µm

Tissue FFPE Sections, Peritoneum

Sign In for Pricing
View Details
HER-2 / CD340 (ERB2/776), CF488A conjugate, 0.1mg/mL
BNC880776-500 1x 500 µL

HER-2 / CD340 (ERB2/776), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tissue Total RNA, Lung
CR562401 5 µg

Tissue Total RNA, Lung

Sign In for Pricing
View Details