Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor gamma variable 2 (TRGV2), Biotinylated

This Recombinant Human T cell receptor gamma variable 2 (TRGV2), Biotinylated spans the amino acid sequence from region 18-118. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor gamma variable 2 TRGV2 TCRGV2

UniProt

A0A075B6R0

Expression Region

18-118

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

KSSNLEGRTKSVIRQTGSSAEITCDLAEGSNGYIHWYLHQEGKAPQRLQYYDSYNSKVVLESGVSPGKYYTYASTRNNLRLILRNLIENDFGVYYCATWDG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Zebrafish TBX1 Rabbit Polyclonal Antibody (Cy3)
orb3002781 100 µg

Zebrafish TBX1 Rabbit Polyclonal Antibody (Cy3)

Sign In for Pricing
View Details
Rabbit Par4 Antibody
orb1527234-01 10 µL

Rabbit Par4 Antibody

Sign In for Pricing
View Details
Rabbit Par4 Antibody
orb1527234-02 100 µL

Rabbit Par4 Antibody

Sign In for Pricing
View Details
PHR1 (PLEKHB1) (NM_001130035) Human Recombinant Protein
TP325204 20 µg

PHR1 (PLEKHB1) (NM_001130035) Human Recombinant Protein

Sign In for Pricing
View Details
ARFRP1 Recombinant Antibody, AbBy Fluor™ 555 Conjugated
bsm-62594R-BF555-TR 20 µL

ARFRP1 Recombinant Antibody, AbBy Fluor™ 555 Conjugated

Sign In for Pricing
View Details
4-​Chloroaniline-d4
431839-01 5 mg

4-​Chloroaniline-d4

Sign In for Pricing
View Details