Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 4-4 (HV404), Biotinylated

This Recombinant Human Immunoglobulin heavy variable 4-4 (HV404), Biotinylated spans the amino acid sequence from region 20-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 4-4 IGHV4-4

UniProt

A0A075B6R2

Expression Region

20-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QVQLQESGPGLVKPSGTLSLTCAVSGGSISSSNWWSWVRQPPGKGLEWIGEIYHSGSTNYNPSLKSRVTISVDKSKNQFSLKLSSVTAADTAVYYCAR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD177 shRNA Plasmid (h)
sc-105189-SH 20 µg

CD177 shRNA Plasmid (h)

Sign In for Pricing
View Details
Interleukin 8 Receptor Alpha (IL8Ra) Polyclonal Antibody
CAU33399-01 100 µL

Interleukin 8 Receptor Alpha (IL8Ra) Polyclonal Antibody

Sign In for Pricing
View Details
Interleukin 8 Receptor Alpha (IL8Ra) Polyclonal Antibody
CAU33399-02 200 µL

Interleukin 8 Receptor Alpha (IL8Ra) Polyclonal Antibody

Sign In for Pricing
View Details
Interleukin 8 Receptor Alpha (IL8Ra) Polyclonal Antibody
CAU33399-03 1 mL

Interleukin 8 Receptor Alpha (IL8Ra) Polyclonal Antibody

Sign In for Pricing
View Details
Dsg1a 3'UTR GFP Stable Cell Line
TU155406 1.0 mL

Dsg1a 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Human Protein S (PROS) ELISA Kit
RD-PROS-Hu-96Tests 96 Tests

Human Protein S (PROS) ELISA Kit

Sign In for Pricing
View Details