Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Probable non-functional immunoglobulin kappa variable 2D-24 (KVD24), Biotinylated

This Recombinant Human Probable non-functional immunoglobulin kappa variable 2D-24 (KVD24), Biotinylated spans the amino acid sequence from region 20-120. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Probable non-functional immunoglobulin kappa variable 2D-24 IGKV2D-24

UniProt

A0A075B6R9

Expression Region

20-120

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GDIVMTQTPLSSPVTLGQPASISFRSSQSLVHSDGNTYLSWLQQRPGQPPRLLIYKVSNRFSGVPDRFSGSGAGTDFTLKISRVEAEDVGVYYCTQATQFP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HELT Protein Vector (Human) (pPB-C-His)
PV082685 500 ng

HELT Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details
PMS1 Rabbit Polyclonal Antibody (Cy7)
orb1015034 100 µL

PMS1 Rabbit Polyclonal Antibody (Cy7)

Sign In for Pricing
View Details
VEGI Polyclonal Antibody
E20-74873 100 µg

VEGI Polyclonal Antibody

Sign In for Pricing
View Details
MECP2 Antibody
orb192893-01 50 μL

MECP2 Antibody

Sign In for Pricing
View Details
MECP2 Antibody
orb192893-02 100 µL

MECP2 Antibody

Sign In for Pricing
View Details
Goat Cytochrome c oxidase assembly protein COX19 (COX19) ELISA Kit
GTR10353110 96 Well

Goat Cytochrome c oxidase assembly protein COX19 (COX19) ELISA Kit

Sign In for Pricing
View Details