Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin kappa variable 2D-29 (KVD29), Biotinylated

This Recombinant Human Immunoglobulin kappa variable 2D-29 (KVD29), Biotinylated spans the amino acid sequence from region 21-120. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin kappa variable 2D-29 IGKV2D-29

UniProt

A0A075B6S2

Expression Region

21-120

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

DIVMTQTPLSLSVTPGQPASISCKSSQSLLHSDGKTYLYWYLQKPGQPPQLLIYEVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQSIQLP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MC3R AAV siRNA Pooled Vector
28194161 1.0 µg

MC3R AAV siRNA Pooled Vector

Sign In for Pricing
View Details
RAB41 Protein Lysate (Human) with C-Ha Tag
38345031 100 µg

RAB41 Protein Lysate (Human) with C-Ha Tag

Sign In for Pricing
View Details
Human HLA-G Pre-designed siRNA Set A
SI007107A 1 Each

Human HLA-G Pre-designed siRNA Set A

Sign In for Pricing
View Details
TTF1 Rabbit mAb
C05937-100uL*2 2x 100μL

TTF1 Rabbit mAb

Sign In for Pricing
View Details
ILKAP
524397-01 100 µL

ILKAP

Sign In for Pricing
View Details
ILKAP
524397-02 200 µL

ILKAP

Sign In for Pricing
View Details