Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin kappa variable 2D-29 (KVD29), Biotinylated

This Recombinant Human Immunoglobulin kappa variable 2D-29 (KVD29), Biotinylated spans the amino acid sequence from region 21-120. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin kappa variable 2D-29 IGKV2D-29

UniProt

A0A075B6S2

Expression Region

21-120

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

DIVMTQTPLSLSVTPGQPASISCKSSQSLLHSDGKTYLYWYLQKPGQPPQLLIYEVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQSIQLP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PSMC5 (NM_002805) Human Recombinant Protein
TP301251 20 µg

PSMC5 (NM_002805) Human Recombinant Protein

Sign In for Pricing
View Details
Anti-UB2E2 UBE2E2 Antibody
A07193 100 µL

Anti-UB2E2 UBE2E2 Antibody

Sign In for Pricing
View Details
CHADL Human qPCR Primer Pair (NM_138481)
HP228372 200 Reactions

CHADL Human qPCR Primer Pair (NM_138481)

Sign In for Pricing
View Details
Fmoc-Hyp-OH
A7599-25000 25 g

Fmoc-Hyp-OH

Sign In for Pricing
View Details
ZP2 Rabbit Polyclonal Antibody (PE-Cy5.5)
orb965067 100 µL

ZP2 Rabbit Polyclonal Antibody (PE-Cy5.5)

Sign In for Pricing
View Details
Cysteine Rich Protein, Angiogenic Inducer 61 (CYR61) BioAssayTM ELISA Kit (Mouse)
024531 96 Tests

Cysteine Rich Protein, Angiogenic Inducer 61 (CYR61) BioAssayTM ELISA Kit (Mouse)

Sign In for Pricing
View Details