Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin kappa variable 1D-17 (KVD17), Biotinylated

This Recombinant Human Immunoglobulin kappa variable 1D-17 (KVD17), Biotinylated spans the amino acid sequence from region 23-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin kappa variable 1D-17 IGKV1D-17

UniProt

A0A075B6S4

Expression Region

23-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

NIQMTQSPSAMSASVGDRVTITCRARQGISNYLAWFQQKPGKVPKHLIYAASSLQSGVPSRFSGSGSGTEFTLTISSLQPEDFATYYCLQHNSYP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

COL4A6, ID (COL4A6, Collagen alpha-6(IV) chain) (MaxLight 490)
MBS6287719-01 0.1 mL

COL4A6, ID (COL4A6, Collagen alpha-6(IV) chain) (MaxLight 490)

Sign In for Pricing
View Details
COL4A6, ID (COL4A6, Collagen alpha-6(IV) chain) (MaxLight 490)
MBS6287719-02 5x 0.1 mL

COL4A6, ID (COL4A6, Collagen alpha-6(IV) chain) (MaxLight 490)

Sign In for Pricing
View Details
PCMV-ATP6V0D1-Neo Plasmid
PVT81500 2 µg

PCMV-ATP6V0D1-Neo Plasmid

Sign In for Pricing
View Details
EEPD1 (NM_030636) Human Tagged Lenti ORF Clone
RC208988L2 10 µg

EEPD1 (NM_030636) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Ppap2b sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
37290116 3x 1.0 µg

Ppap2b sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details
Recombinant Bacillus subtilis Uncharacterized HTH-type transcriptional regulator yvmB (yvmB)
MBS1132604-01 0.02 mg (E-Coli)

Recombinant Bacillus subtilis Uncharacterized HTH-type transcriptional regulator yvmB (yvmB)

Sign In for Pricing
View Details