Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin kappa variable 2D-30 (KVD30), Biotinylated

This Recombinant Human Immunoglobulin kappa variable 2D-30 (KVD30), Biotinylated spans the amino acid sequence from region 21-120. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin kappa variable 2D-30 IGKV2D-30

UniProt

A0A075B6S6

Expression Region

21-120

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

DVVMTQSPLSLPVTLGQPASISCRSSQSLVYSDGNTYLNWFQQRPGQSPRRLIYKVSNWDSGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQGTHWP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Zfp746 Mouse Gene Knockout Kit (CRISPR)
KN519962 1 Kit

Zfp746 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Elab Fluor® 488 Anti-Mouse TCRβ Antibody[H57-597]
E-AB-F1123L-01 50 Tests

Elab Fluor® 488 Anti-Mouse TCRβ Antibody[H57-597]

Sign In for Pricing
View Details
Elab Fluor® 488 Anti-Mouse TCRβ Antibody[H57-597]
E-AB-F1123L-02 100 Tests

Elab Fluor® 488 Anti-Mouse TCRβ Antibody[H57-597]

Sign In for Pricing
View Details
Elab Fluor® 488 Anti-Mouse TCRβ Antibody[H57-597]
E-AB-F1123L-03 2x 100 Tests

Elab Fluor® 488 Anti-Mouse TCRβ Antibody[H57-597]

Sign In for Pricing
View Details
Coiled Coil Domain Containing Protein 3 (CCDC3) (C-term) Rabbit Polyclonal Antibody
AP17927PU-N 400 µL

Coiled Coil Domain Containing Protein 3 (CCDC3) (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Weigh Boats
B6502B 500 Sheets/Pack

Weigh Boats

Sign In for Pricing
View Details