Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin kappa variable 2D-30 (KVD30), Biotinylated

This Recombinant Human Immunoglobulin kappa variable 2D-30 (KVD30), Biotinylated spans the amino acid sequence from region 21-120. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin kappa variable 2D-30 IGKV2D-30

UniProt

A0A075B6S6

Expression Region

21-120

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

DVVMTQSPLSLPVTLGQPASISCRSSQSLVYSDGNTYLNWFQQRPGQSPRRLIYKVSNWDSGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQGTHWP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

VPS53 (N-term) Rabbit Polyclonal Antibody
AP18239PU-N 400 µL

VPS53 (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Frozen Tissue Sections, Thyroid gland
CS506266 5x 5 µm

Frozen Tissue Sections, Thyroid gland

Sign In for Pricing
View Details
Human IgG Immunoglobulin (IG266), CF568 conjugate, 0.1mg/mL
BNC680266-500 1x 500 µL

Human IgG Immunoglobulin (IG266), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytidine- 5'-triphosphate -1',2',3',4',5'-13C5 Triethylamine Salt, >90%
TRC-C258655-5MG 5 mg

Cytidine- 5'-triphosphate -1',2',3',4',5'-13C5 Triethylamine Salt, >90%

Sign In for Pricing
View Details
Atp4a Mouse Gene Knockout Kit (CRISPR)
KN501785 1 Kit

Atp4a Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
MTURN Human Gene Knockout Kit (CRISPR)
KN422751 1 Kit

MTURN Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details