Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Probable non-functional immunoglobulinn kappa variable 1-37 (KV137), Biotinylated

This Recombinant Human Probable non-functional immunoglobulinn kappa variable 1-37 (KV137), Biotinylated spans the amino acid sequence from region 23-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Probable non-functional immunoglobulinn kappa variable 1-37 IGKV1-37

UniProt

A0A075B6S9

Expression Region

23-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

DIQLTQSPSSLSASVGDRVTITCRVSQGISSYLNWYRQKPGKVPKLLIYSASNLQSGVPSRFSGSGSGTDFTLTISSLQPEDVATYYGQRTYNAP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

N- (3-Aminobenzyl) -6- (4- ((3-fluorobenzyl) oxy) phenoxy) nicotinamide dihydrochloride
PC1007695-01 1 mg

N- (3-Aminobenzyl) -6- (4- ((3-fluorobenzyl) oxy) phenoxy) nicotinamide dihydrochloride

Sign In for Pricing
View Details
N- (3-Aminobenzyl) -6- (4- ((3-fluorobenzyl) oxy) phenoxy) nicotinamide dihydrochloride
PC1007695-02 5 mg

N- (3-Aminobenzyl) -6- (4- ((3-fluorobenzyl) oxy) phenoxy) nicotinamide dihydrochloride

Sign In for Pricing
View Details
N- (3-Aminobenzyl) -6- (4- ((3-fluorobenzyl) oxy) phenoxy) nicotinamide dihydrochloride
PC1007695-03 10 mg

N- (3-Aminobenzyl) -6- (4- ((3-fluorobenzyl) oxy) phenoxy) nicotinamide dihydrochloride

Sign In for Pricing
View Details
N- (3-Aminobenzyl) -6- (4- ((3-fluorobenzyl) oxy) phenoxy) nicotinamide dihydrochloride
PC1007695-04 25 mg

N- (3-Aminobenzyl) -6- (4- ((3-fluorobenzyl) oxy) phenoxy) nicotinamide dihydrochloride

Sign In for Pricing
View Details
N- (3-Aminobenzyl) -6- (4- ((3-fluorobenzyl) oxy) phenoxy) nicotinamide dihydrochloride
PC1007695-05 50 mg

N- (3-Aminobenzyl) -6- (4- ((3-fluorobenzyl) oxy) phenoxy) nicotinamide dihydrochloride

Sign In for Pricing
View Details
Pigeon Probable G-Protein Coupled Receptor 173 (GPR173) ELISA Kit
MBS9942824 Inquire

Pigeon Probable G-Protein Coupled Receptor 173 (GPR173) ELISA Kit

Sign In for Pricing
View Details