Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 6 (TVA6), Biotinylated

This Recombinant Human T cell receptor alpha variable 6 (TVA6), Biotinylated spans the amino acid sequence from region 41-132. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 6 TRAV6 TCRAV5S1

UniProt

A0A075B6T7

Expression Region

41-132

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QKIEQNSEALNIQEGKTATLTCNYTNYSPAYLQWYRQDPGRGPVFLLLIRENEKEKRKERLKVTFDTTLKQSLFHITASQPADSATYLCALD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

UBQLN3 Antibody
A33677-50UG 50 µg

UBQLN3 Antibody

Sign In for Pricing
View Details
Multiplex Assay Kit for Phenylalanine Hydroxylase (PAH), etc. by FLIA (Flow Luminescence Immunoassay)
TRV-0029494 96 Tests

Multiplex Assay Kit for Phenylalanine Hydroxylase (PAH), etc. by FLIA (Flow Luminescence Immunoassay)

Sign In for Pricing
View Details
Pxmp2 shRNA Plasmid (m)
sc-152603-SH 20 µg

Pxmp2 shRNA Plasmid (m)

Sign In for Pricing
View Details
Mouse Calretinin ELISA Kit
orb1661115 96 Tests

Mouse Calretinin ELISA Kit

Sign In for Pricing
View Details
BMX Non Receptor Tyrosine Kinase Phospho-Tyr40 (BMX pY40) Antibody
abx326171-01 50 µg

BMX Non Receptor Tyrosine Kinase Phospho-Tyr40 (BMX pY40) Antibody

Sign In for Pricing
View Details
BMX Non Receptor Tyrosine Kinase Phospho-Tyr40 (BMX pY40) Antibody
abx326171-02 100 µg

BMX Non Receptor Tyrosine Kinase Phospho-Tyr40 (BMX pY40) Antibody

Sign In for Pricing
View Details