Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 9-1 (TVA91), Biotinylated

This Recombinant Human T cell receptor alpha variable 9-1 (TVA91), Biotinylated spans the amino acid sequence from region 21-112. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 9-1 TRAV9-1

UniProt

A0A075B6T8

Expression Region

21-112

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

DSVVQTEGQVLPSEGDSLIVNCSYETTQYPSLFWYVQYPGEGPQLHLKAMKANDKGRNKGFEAMYRKETTSFHLEKDSVQESDSAVYFCALS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human OR52M1 activation kit by CRISPRa
GA114704 1 Kit

Human OR52M1 activation kit by CRISPRa

Sign In for Pricing
View Details
Frozen Tissue Sections, Lung
CS633328 5x 5 µm

Frozen Tissue Sections, Lung

Sign In for Pricing
View Details
Caldesmon, HMW (h-Caldesmon) (h-CALD), CF405S conjugate, 0.1mg/mL
BNC040819-100 1x 100 µL

Caldesmon, HMW (h-Caldesmon) (h-CALD), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD31 Recombinant Chimeric Antibody Antibody
HA601522 100 µL

CD31 Recombinant Chimeric Antibody Antibody

Sign In for Pricing
View Details
8,10-Dihydroxy-cannabinol
TRC-D448803-5MG 5 mg

8,10-Dihydroxy-cannabinol

Sign In for Pricing
View Details
B Raf (BRAF) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4C11]
TA500462BM 100 µL

B Raf (BRAF) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4C11]

Sign In for Pricing
View Details