Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 9-1 (TVA91), Biotinylated

This Recombinant Human T cell receptor alpha variable 9-1 (TVA91), Biotinylated spans the amino acid sequence from region 21-112. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 9-1 TRAV9-1

UniProt

A0A075B6T8

Expression Region

21-112

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

DSVVQTEGQVLPSEGDSLIVNCSYETTQYPSLFWYVQYPGEGPQLHLKAMKANDKGRNKGFEAMYRKETTSFHLEKDSVQESDSAVYFCALS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mrps36 (NM_025369) Mouse Tagged ORF Clone
MG200323 10 µg

Mrps36 (NM_025369) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
NUDT10 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2G8]
TA804113BM 100 µL

NUDT10 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2G8]

Sign In for Pricing
View Details
Human RIIAD1 activation kit by CRISPRa
GA117158 1 Kit

Human RIIAD1 activation kit by CRISPRa

Sign In for Pricing
View Details
ORAI2 Human Gene Knockout Kit (CRISPR)
KN421137 1 Kit

ORAI2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Mouse IL-13, C-His, Flag Tag
HA210571-01 20 µg

Mouse IL-13, C-His, Flag Tag

Sign In for Pricing
View Details
Mouse IL-13, C-His, Flag Tag
HA210571-02 50 µg

Mouse IL-13, C-His, Flag Tag

Sign In for Pricing
View Details