Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 9-1 (TVA91), Biotinylated

This Recombinant Human T cell receptor alpha variable 9-1 (TVA91), Biotinylated spans the amino acid sequence from region 21-112. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 9-1 TRAV9-1

UniProt

A0A075B6T8

Expression Region

21-112

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

DSVVQTEGQVLPSEGDSLIVNCSYETTQYPSLFWYVQYPGEGPQLHLKAMKANDKGRNKGFEAMYRKETTSFHLEKDSVQESDSAVYFCALS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

UNC5C Human Gene Knockout Kit (CRISPR)
KN424257 1 Kit

UNC5C Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Tissue FFPE Sections, Prostate
CS713966 5x 5 µm

Tissue FFPE Sections, Prostate

Sign In for Pricing
View Details
ACOT7 (1-370) Mouse Monoclonal Antibody [Clone ID: AT1D5]
AM50031PU-N 100 µL

ACOT7 (1-370) Mouse Monoclonal Antibody [Clone ID: AT1D5]

Sign In for Pricing
View Details
PODXL Mouse Monoclonal Antibody [Clone ID: 53D11]
AM26622AF-N 100 µg

PODXL Mouse Monoclonal Antibody [Clone ID: 53D11]

Sign In for Pricing
View Details
Rad9 (RAD9A) Rabbit Polyclonal Antibody
TA380677 100 µL

Rad9 (RAD9A) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
N1,N4-Bis-(7-chloroquinolin-4-yl)-N1-ethylpentane-1,4-diamine
TRC-B419140-2.5MG 2.5 mg

N1,N4-Bis-(7-chloroquinolin-4-yl)-N1-ethylpentane-1,4-diamine

Sign In for Pricing
View Details