Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 7 (TVA7), Biotinylated

This Recombinant Human T cell receptor alpha variable 7 (TVA7), Biotinylated spans the amino acid sequence from region 22-112. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 7 TRAV7

UniProt

A0A075B6U4

Expression Region

22-112

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

ENQVEHSPHFLGPQQGDVASMSCTYSVSRFNNLQWYRQNTGMGPKHLLSMYSAGYEKQKGRLNATLLKNGSSLYITAVQPEDSATYFCAVD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Colloidal Gold Conjugated Lens culinaris Lectin (Lentil) -LcH-,  20nm
GP-1401-20 1 mL

Colloidal Gold Conjugated Lens culinaris Lectin (Lentil) -LcH-, 20nm

Sign In for Pricing
View Details
Trpc4ap Mouse Gene Knockout Kit (CRISPR)
KN518293 1 Kit

Trpc4ap Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Cytokeratin, pan (KRTL/1077 + KRTH/1076), CF568 conjugate, 0.1mg/mL
BNC681100-500 1x 500 µL

Cytokeratin, pan (KRTL/1077 + KRTH/1076), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Colloidal Gold Conjugated Goat Affinity Purified Antibody to Human Immunoglobulins,  5nm
GAF-006-5 1 mL

Colloidal Gold Conjugated Goat Affinity Purified Antibody to Human Immunoglobulins, 5nm

Sign In for Pricing
View Details
Human Lambda Light Chain (ICO-106), CF405S conjugate, 0.1mg/mL
BNC040019-100 1x 100 µL

Human Lambda Light Chain (ICO-106), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant Human CRYAB Protein (His Tag)
PKSH033245-01 10 µg

Recombinant Human CRYAB Protein (His Tag)

Sign In for Pricing
View Details