Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 7 (TVA7), Biotinylated

This Recombinant Human T cell receptor alpha variable 7 (TVA7), Biotinylated spans the amino acid sequence from region 22-112. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 7 TRAV7

UniProt

A0A075B6U4

Expression Region

22-112

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

ENQVEHSPHFLGPQQGDVASMSCTYSVSRFNNLQWYRQNTGMGPKHLLSMYSAGYEKQKGRLNATLLKNGSSLYITAVQPEDSATYFCAVD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BRAT1 Recombinant Rabbit Monoclonal Antibody [JE64-71]
HA721091 100 µL

BRAT1 Recombinant Rabbit Monoclonal Antibody [JE64-71]

Sign In for Pricing
View Details
Mannosidase II (MAN2A1) (NM_002372) Human Over-expression Lysate
LY419367 100 µg

Mannosidase II (MAN2A1) (NM_002372) Human Over-expression Lysate

Sign In for Pricing
View Details
NDUFB6 (NM_002493) Human Over-expression Lysate
LY419293 100 µg

NDUFB6 (NM_002493) Human Over-expression Lysate

Sign In for Pricing
View Details
Vmn1r213 Mouse Gene Knockout Kit (CRISPR)
KN519007 1 Kit

Vmn1r213 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
BrdU (Bromodeoxyuridine) (BRD469), 0.2mg/mL
BNUB0469-500 1x 500 µL

BrdU (Bromodeoxyuridine) (BRD469), 0.2mg/mL

Sign In for Pricing
View Details
Ksp-Cadherin / CDH16 (Renal Cell Marker) (CDH16/2125), CF647 conjugate, 0.1mg/mL
BNC472125-100 1x 100 µL

Ksp-Cadherin / CDH16 (Renal Cell Marker) (CDH16/2125), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details