Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 23/delta variable 6 (TVA23), Biotinylated

This Recombinant Human T cell receptor alpha variable 23/delta variable 6 (TVA23), Biotinylated spans the amino acid sequence from region 22-121. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 23/delta variable 6 TRAV23DV6

UniProt

A0A075B6W5

Expression Region

22-121

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QQKEKSDQQQVKQSPQSLIVQKGGISIINCAYENTAFDYFPWYQQFPGKGPALLIAIRPDVSEKKEGRFTISFNKSAKQFSSHIMDSQPGDSATYFCAAS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human AKAP14 sgRNA gene knockout kit - Lentiviral human AKAP14 sgRNA gene knockout kit (plasmid)
GTR15360743 1 Vial

Lentiviral human AKAP14 sgRNA gene knockout kit - Lentiviral human AKAP14 sgRNA gene knockout kit (plasmid)

Sign In for Pricing
View Details
CETN2 (Centrin-2, Caltractin Isoform 1, CALT, CEN2) (HRP)
124888-HRP 100 µL

CETN2 (Centrin-2, Caltractin Isoform 1, CALT, CEN2) (HRP)

Sign In for Pricing
View Details
WDR77 Rabbit Polyclonal Antibody (Biotin)
orb2099710 100 µL

WDR77 Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
Leptin Receptor Monoclonal Antibody, Cy5 Conjugated
bsm-61055R-Cy5 100 µL

Leptin Receptor Monoclonal Antibody, Cy5 Conjugated

Sign In for Pricing
View Details
Recombinant Human LCN2 Protein, N-His
AP91968 50 µg

Recombinant Human LCN2 Protein, N-His

Sign In for Pricing
View Details
BID (I72) polyclonal antibody
BS1819 50ul

BID (I72) polyclonal antibody

Sign In for Pricing
View Details