Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 23/delta variable 6 (TVA23), Biotinylated

This Recombinant Human T cell receptor alpha variable 23/delta variable 6 (TVA23), Biotinylated spans the amino acid sequence from region 22-121. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 23/delta variable 6 TRAV23DV6

UniProt

A0A075B6W5

Expression Region

22-121

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QQKEKSDQQQVKQSPQSLIVQKGGISIINCAYENTAFDYFPWYQQFPGKGPALLIAIRPDVSEKKEGRFTISFNKSAKQFSSHIMDSQPGDSATYFCAAS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Zebrafish NF-κB p65/RELA Antibody Picoband® HRP Conjugated
AZA0A8M2BI19-HRP 100 µg/Vial

Anti-Zebrafish NF-κB p65/RELA Antibody Picoband® HRP Conjugated

Sign In for Pricing
View Details
Mouse Caveolin 1 (CAV1) ELISA Kit
RD-CAV1-Mu-01 96 Tests

Mouse Caveolin 1 (CAV1) ELISA Kit

Sign In for Pricing
View Details
Mouse Caveolin 1 (CAV1) ELISA Kit
RD-CAV1-Mu-02 48 Tests

Mouse Caveolin 1 (CAV1) ELISA Kit

Sign In for Pricing
View Details
AAO Antibody
CSB-PA333022LA01DZK-01 50 µg

AAO Antibody

Sign In for Pricing
View Details
AAO Antibody
CSB-PA333022LA01DZK-02 100 µg

AAO Antibody

Sign In for Pricing
View Details
Recombinant Human GDF-5/BMP-14
P5792-10μg 10 µg

Recombinant Human GDF-5/BMP-14

Sign In for Pricing
View Details