Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Putative aquaporin-7B (AQP7B), partial, Biotinylated

This Recombinant Human Putative aquaporin-7B (AQP7B), partial, Biotinylated spans the amino acid sequence from region 137-174. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Putative aquaporin-7B AQP7B

UniProt

A0A075B734

Expression Region

137-174

Origin

Homo sapiens (Human)

Field of Research

Kidney & Urological Research

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

LFYTAILHFSGGELMVTGPFATAGIFATYLPDHMTLWR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Methyl 5-amino-2-bromo-4-fluorobenzoate
PC111629-01 100 mg

Methyl 5-amino-2-bromo-4-fluorobenzoate

Sign In for Pricing
View Details
Methyl 5-amino-2-bromo-4-fluorobenzoate
PC111629-02 250 mg

Methyl 5-amino-2-bromo-4-fluorobenzoate

Sign In for Pricing
View Details
Methyl 5-amino-2-bromo-4-fluorobenzoate
PC111629-03 1 g

Methyl 5-amino-2-bromo-4-fluorobenzoate

Sign In for Pricing
View Details
Methyl 5-amino-2-bromo-4-fluorobenzoate
PC111629-04 5 g

Methyl 5-amino-2-bromo-4-fluorobenzoate

Sign In for Pricing
View Details
TAS1R3, NT (TAS1R3, T1R3, TR3, Taste receptor type 1 member 3, Sweet taste receptor T1R3)
042607 200 µL

TAS1R3, NT (TAS1R3, T1R3, TR3, Taste receptor type 1 member 3, Sweet taste receptor T1R3)

Sign In for Pricing
View Details
NFATC4 Rabbit pAb (APR23758N)
APR23758N-01 50 µL

NFATC4 Rabbit pAb (APR23758N)

Sign In for Pricing
View Details