Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin lambda variable 5-45 (LV545), Biotinylated

This Recombinant Human Immunoglobulin lambda variable 5-45 (LV545), Biotinylated spans the amino acid sequence from region 20-123. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin lambda variable 5-45 IGLV5-45

UniProt

A0A087WSX0

Expression Region

20-123

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QAVLTQPSSLSASPGASASLTCTLCSGINVGTYRIYWYQQKPGSPPQYLLRYKSDSDKQQGSGVPSRFSGSKDASANAGILLISGLQSEDEADYYCMIWHSSAS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HTR1A (Center) Rabbit pAb
E2617549 100 µL

HTR1A (Center) Rabbit pAb

Sign In for Pricing
View Details
Magic™ Membrane Protein Human PLLP (Plasmolipin) Full Length
MPC1112K Each

Magic™ Membrane Protein Human PLLP (Plasmolipin) Full Length

Sign In for Pricing
View Details
PCLKC (CDHR2) (NM_017675) Human Tagged Lenti ORF Clone
RC212526L3 10 µg

PCLKC (CDHR2) (NM_017675) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Cisd1 sgRNA CRISPR Lentivector (Rat) (Target 2)
K6754503 1.0 µg DNA

Cisd1 sgRNA CRISPR Lentivector (Rat) (Target 2)

Sign In for Pricing
View Details
Nrf2 (Acetyl Lys599) rabbit pAb
ES1138-01 50 µL

Nrf2 (Acetyl Lys599) rabbit pAb

Sign In for Pricing
View Details
Nrf2 (Acetyl Lys599) rabbit pAb
ES1138-02 100 µL

Nrf2 (Acetyl Lys599) rabbit pAb

Sign In for Pricing
View Details